Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G01250_circ_g.7 |
ID in PlantcircBase | ath_circ_012416 |
Alias | Ath_circ_FC0029 |
Organism | Arabidpsis thaliana |
Position | chr2: 134091-134273 JBrowse» |
Reference genome | TAIR10.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, CIRI, KNIFE, PcircRNA_finder, circRNA_finder, find_circ, CIRI-full |
Parent gene | AT2G01250 |
Parent gene annotation |
60S ribosomal protein L7-2 |
Parent gene strand | - |
Alternative splicing | AT2G01250_circ_g.1 AT2G01250_circ_g.2 AT2G01250_circ_g.3 AT2G01250_circ_g.4 AT2G01250_circ_g.5 AT2G01250_circ_g.6 AT2G01250_circ_g.8 |
Support reads | 246 |
Tissues | root, leaf, inflorescences, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G01250.2:1 AT2G01250.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.679641981 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
134265-134093(-) |
Potential amino acid sequence |
MVESKVVVPESVLKKRKREEEWALEKKQNVEAAKKKNAENRKLIFKRAEQYSKEYAEKDSEMVE SKVVVPESVLKKRKREEEWALEKKQNVEAAKKKNAENRKLIFKRAEQYSKEYAEKDSEMVESKV VVPESVLKKRKREEEWALEKKQNVEAAKKKNAENRKLIFKRAEQYSKEYAEKDSEMVESKVVVP ESVLKKRKREEEWALEKKQNVEAAKKKNAENRKLIFKRAEQYSKEYAEK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017;Chen et al., 2017a |