Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0714000_circ_g.1 |
ID in PlantcircBase | osa_circ_016238 |
Alias | Os_ciR8033 |
Organism | Oryza sativa |
Position | chr2: 29595186-29595991 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os02g0714000 |
Parent gene annotation |
Similar to Yarrowia lipolytica chromosome C of strain CLIB99 of Yarrowia lipolytica. (Os02t0714000-01);Similar to Yarrowia lipol ytica chromosome C of strain CLIB99 of Yarrowia lipolytica. (Os0 2t0714000-02);Hypothetical gene. (Os02t0714000-03) |
Parent gene strand | + |
Alternative splicing | Os02g0714000_circ_g.2 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0714000-01:2 Os02t0714000-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.345390984 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29595932-29595202(+) 29595224-29595878(-) |
Potential amino acid sequence |
MVSTGHFLLGITKDSRFRNTGDVPRS*(+) MPSSPTQDRGTSPVLRNRESLVIPKRKCPVLTITPYINTPWNWNAKVGPS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |