Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0714000_circ_g.1 |
| ID in PlantcircBase | osa_circ_016238 |
| Alias | Os_ciR8033 |
| Organism | Oryza sativa |
| Position | chr2: 29595186-29595991 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os02g0714000 |
| Parent gene annotation |
Similar to Yarrowia lipolytica chromosome C of strain CLIB99 of Yarrowia lipolytica. (Os02t0714000-01);Similar to Yarrowia lipol ytica chromosome C of strain CLIB99 of Yarrowia lipolytica. (Os0 2t0714000-02);Hypothetical gene. (Os02t0714000-03) |
| Parent gene strand | + |
| Alternative splicing | Os02g0714000_circ_g.2 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0714000-01:2 Os02t0714000-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.345390984 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29595932-29595202(+) 29595224-29595878(-) |
| Potential amino acid sequence |
MVSTGHFLLGITKDSRFRNTGDVPRS*(+) MPSSPTQDRGTSPVLRNRESLVIPKRKCPVLTITPYINTPWNWNAKVGPS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |