Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc08g083320.2_circ_g.1 |
| ID in PlantcircBase | sly_circ_002741 |
| Alias | Slcirc128 |
| Organism | Solanum lycopersicum |
| Position | chr8: 65817916-65818322 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc08g083320.2 |
| Parent gene annotation |
Granule-bound starch synthase 1, chloroplastic/amyloplastic |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 10 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc08g083320.2.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.236797625 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
65818240-65818302(-) 65817920-65818302(-) |
| Potential amino acid sequence |
MFLEKVWGKTGSKIYGPKAGLDYLDNELRFSLLCQAALEAPRVLNLNSSNYFSGPYGQSWRQH* (-) MVKVGDSIEIVRFFHCYKRGVDRVFVDHPMFLEKVWGKTGSKIYGPKAGLDYLDNELRFSLLCQ AALEAPRVLNLNSSNYFSGPYGQSWRQH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Wang et al., 2018b |