Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d003671_circ_g.1 |
| ID in PlantcircBase | zma_circ_007178 |
| Alias | zma_circ_0001067 |
| Organism | Zea mays |
| Position | chr2: 53374260-53374483 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d003671 |
| Parent gene annotation |
Phospholipase C |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d003671_T003:1 Zm00001d003671_T002:1 Zm00001d003671_T001:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.260350153 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
53374275-53374277(+) 53374319-53374463(-) |
| Potential amino acid sequence |
MVKGTCHNRAESAAMNDLSRSLVLVNYFRDLPNLPAACKDNSAQLLDMVTACHDKSGDRWPNFI AVDFYKTGPRGW*(+) MAADSARLWHVPFTIPLVPSCRSPRR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |