Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G48550_circ_g.1 |
| ID in PlantcircBase | ath_circ_006336 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 17951595-17951690 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT1G48550 |
| Parent gene annotation |
Vacuolar protein sorting-associated protein 26 |
| Parent gene strand | - |
| Alternative splicing | AT1G48550_circ_g.2 AT1G48550_circ_g.3 AT1G48550_circ_g.4 |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G48550.2:1 AT1G48550.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.165026312 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17951620-17951687(+) |
| Potential amino acid sequence |
MSLCVLSDVEDDNFRRNRPLGKVNCLNIRQQRMSLCVLSDVEDDNFRRNRPLGKVNCLNIRQQR MSLCVLSDVEDDNFRRNRPLGKVNCLNIRQQRMSLCVLSDVEDDNFRRNRPLGKV(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |