Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0513200_circ_g.2 |
ID in PlantcircBase | osa_circ_001916 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 18103149-18105415 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0513200 |
Parent gene annotation |
Hypothetical conserved gene. (Os01t0513200-01) |
Parent gene strand | - |
Alternative splicing | Os01g0513200_circ_g.1 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0513200-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.100541277 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18105366-18103211(+) 18103236-18105414(-) |
Potential amino acid sequence |
MKQLEYLLGQTIRQCYHLYNPRIPSSSAIRRKADQMLV*(+) MRTGVVPYTSIWSALRRIAEEEGIRGLYR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |