Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.006G177400_circ_g.1 |
| ID in PlantcircBase | gra_circ_000641 |
| Alias | Chr06:43491872|43492239 |
| Organism | Gossypium raimondii |
| Position | chrChr06: 43491872-43492239 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.006G177400 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/5 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.006G177400.1:1 Gorai.006G177400.2:1 Gorai.006G177400.8:1 Gorai.006G177400.7:1 Gorai.006G177400.5:1 Gorai.006G177400.4:1 Gorai.006G177400.3:1 Gorai.006G177400.6:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.988305186 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
43491985-43491910(+) 43491889-43491890(-) 43491881-43492170(-) |
| Potential amino acid sequence |
MASVGSCCLIGIICNGLLYIANAGDSRVVLGRSGRGTKQAKAMQLSVEHNASIDTVREELRSLH PNDPHIVVKKHRVWRVKGLIQHLHLSIKKYQQMF*(+) MLRCKCCIKPLTRQTLCFFTTICGSLGCNDRSSSLTVSILALCSTDNCIALACFVPLPDLPNTT LESPALAIYSSPLQIIPIKQHDPTDAICGLTCHCFLTSERKFSSVVEKAFLRTSADIS*(-) MQMLYQALDTPNSVFLHNDMWIIGMQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |