Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0177600_circ_g.5 |
| ID in PlantcircBase | osa_circ_013455 |
| Alias | Os_ciR8277 |
| Organism | Oryza sativa |
| Position | chr2: 4285302-4285404 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os02g0177600 |
| Parent gene annotation |
4-coumarate:coenzyme A ligase, Lignin biosynthesis, Defense agai nst wounding (Os02t0177600-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0177600-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.203071036 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4285304-4285310(+) 4285311-4285310(+) 4285345-4285362(-) |
| Potential amino acid sequence |
MKDDLAGEVPVAFIVRTEGSEITEDEIKKFVAKEDEG*(+) MILPVKCQSPSLSGQKAQKSPRMRSRNSLQKRMKDDLAGEVPVAFIVRTEGSEITEDEIKKFVA KEDEG*(+) MKATGTSPARSSFILFCNEFLDLILGDF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |