Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0437900_circ_g.2 |
| ID in PlantcircBase | osa_circ_028029 |
| Alias | Os_ciR4863 |
| Organism | Oryza sativa |
| Position | chr5: 21461880-21462675 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Os05g0437900 |
| Parent gene annotation |
Tubby family protein. (Os05t0437900-01);Similar to Tubby-like F- box protein 8. (Os05t0437900-03) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0437900-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.190327178 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21462585-21461910(+) 21462486-21462664(-) |
| Potential amino acid sequence |
MVQLATVPDHADTVRITALVVFTHKQSTIYTSTQAQVEMIS*(+) MSFRSIVRDVRDSFGSLSRRSFEVTLAGLSGLTGHHRGKSQSTVHELCDADLIIQESRWASLPP ELLRDVIRRLEASESTWPSRKDVVSCAAVCKAWREMCKEIVLSPEFCGKLTFPLSLKQPGPRDG MIQCFIKRDKSKSTYHLYLCLSTGIDC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |