Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0671900_circ_g.4 |
| ID in PlantcircBase | osa_circ_025903 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 34284907-34285502 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0671900 |
| Parent gene annotation |
Transcription factor, Regulator for phosphate homeostasis (Os04t 0671900-01);Similar to Auxin response factor 12. (Os04t0671900-0 2);Similar to Auxin response factor 12. (Os04t0671900-03) |
| Parent gene strand | - |
| Alternative splicing | Os04g0671900_circ_g.5 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0671900-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_014998 |
| PMCS | 0.168839262 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34285378-34285204(+) 34285404-34285448(-) |
| Potential amino acid sequence |
MLAADDELISSSSDQTREAQTLNLSPHKSTRKPHPPPQIGRIMHCDIVELADQLRRQVGVVRDV TLHLLVRRRRHLLAVALREVDDARADGGEADERAGAGVP*(+) MSSSSAASIGPPQPPPPPAPPEEEKKCLNSELWHACAGPLVCLPTVGTRVVYFPQGHSEQVAAS TNKEVEGHIPNYPNLPAQLICQLHDVTMHNAADLRRGMGFSGGFVRG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |