Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0671900_circ_g.4 |
ID in PlantcircBase | osa_circ_025903 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 34284907-34285502 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0671900 |
Parent gene annotation |
Transcription factor, Regulator for phosphate homeostasis (Os04t 0671900-01);Similar to Auxin response factor 12. (Os04t0671900-0 2);Similar to Auxin response factor 12. (Os04t0671900-03) |
Parent gene strand | - |
Alternative splicing | Os04g0671900_circ_g.5 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0671900-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_014998 |
PMCS | 0.168839262 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
34285378-34285204(+) 34285404-34285448(-) |
Potential amino acid sequence |
MLAADDELISSSSDQTREAQTLNLSPHKSTRKPHPPPQIGRIMHCDIVELADQLRRQVGVVRDV TLHLLVRRRRHLLAVALREVDDARADGGEADERAGAGVP*(+) MSSSSAASIGPPQPPPPPAPPEEEKKCLNSELWHACAGPLVCLPTVGTRVVYFPQGHSEQVAAS TNKEVEGHIPNYPNLPAQLICQLHDVTMHNAADLRRGMGFSGGFVRG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |