Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0478500_circ_g.4 |
| ID in PlantcircBase | osa_circ_037353 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 23595367-23597657 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0478500 |
| Parent gene annotation |
Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 family pr otein. (Os08t0478500-01) |
| Parent gene strand | - |
| Alternative splicing | Os08g0478500_circ_g.5 Os08g0478500_circ_g.6 Os08g0478500_circ_g.7 Os08g0478500_circ_g.8 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0478500-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.122584265 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23597628-23597457(-) |
| Potential amino acid sequence |
MFTRPLTSYLLGGLHSKNCSKKEWCFMCEFEKLVGEGRQGKIALSPTGILSHLPDIGSSFGPGK QEDAHEFLRYAIDAMQSVCMKEARKSGTHRLHEETTLMQLIFGGYLRSKIRCTRCDATSEQHER ILDLTVEIDGDISSLEGALERFTSTEVLDGDNKYKCSRCKSHERAKKKLTISEAPNVLTIALKR YQLLCKCCSSVLNVYPTTYIISFGRASFKKLFQKGMVLHV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |