Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G10900_circ_g.1 |
| ID in PlantcircBase | ath_circ_037485 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr5: 3436597-3436800 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | AT5G10900 |
| Parent gene annotation |
Calcineurin-like metallo-phosphoesterase superfamily protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | root, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G10900.2:1 AT5G10900.3:1 AT5G10900.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.238157274 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3436753-3436599(-) |
| Potential amino acid sequence |
MWENRTGHGFASMGISNPPSWTVPLPNDPSQILQLREPPQVFEGLPLPDNIQLQHQIISDGSST QQQQMWENRTGHGFASMGISNPPSWTVPLPNDPSQILQLREPPQVFEGLPLPDNIQLQHQIISD GSSTQQQQMWENRTGHGFASMGISNPPSWTVPLPNDPSQILQLREPPQVFEGLPLPDNIQLQHQ IISDGSSTQQQQMWENRTGHGFASMGISNPPSWTVPLPNDPSQILQLREPPQVFEGLPLPDNIQ (-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |