Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G39210_circ_g.2 |
| ID in PlantcircBase | ath_circ_035631 |
| Alias | AT4G39210_C1, AT4G39210_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 18261511-18261752 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT4G39210 |
| Parent gene annotation |
Glucose-1-phosphate adenylyltransferase |
| Parent gene strand | + |
| Alternative splicing | AT4G39210_circ_g.3 AT4G39210_circ_g.4 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G39210.2:2 AT4G39210.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.362758945 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18261751-18261749(+) |
| Potential amino acid sequence |
MHHVDSKADITLSCAPVDESRASEYGLVNIDRSGRVVHFSEKPTGIDLKSMHHVDSKADITLSC APVDESRASEYGLVNIDRSGRVVHFSEKPTGIDLKSMHHVDSKADITLSCAPVDESRASEYGLV NIDRSGRVVHFSEKPTGIDLKSM |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |