Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0559300_circ_g.6 |
ID in PlantcircBase | osa_circ_038078 |
Alias | Os_ciR5626 |
Organism | Oryza sativa |
Position | chr8: 27994605-27995057 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os08g0559300 |
Parent gene annotation |
O-linked N-acetylglucosamine transferase, Negative regulator of gibberellin (GA) signaling, Brassinosteroid (BR) synthesis (Os08 t0559300-01) |
Parent gene strand | + |
Alternative splicing | Os08g0559300_circ_g.2 Os08g0559300_circ_g.3 Os08g0559300_circ_g.4 Os08g0559300_circ_g.5 Os08g0559300_circ_g.7 Os08g0559300_circ_g.8 |
Support reads | 3/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0559300-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.412493837 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
27994815-27994693(+) 27995035-27994693(+) |
Potential amino acid sequence |
MALSIKPNFSQSLNNLGVVYTVQGKMDAASSMIQKAIFANSTYAEAYNNLGYCFLRACSALQSS LCGGMQQPGSNIQGQG*(+) MLKHIITWAIVFYELALHFNPRCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNL GVVYTVQGKMDAASSMIQKAIFANSTYAEAYNNLGYCFLRACSALQSSLCGGMQQPGSNIQGQG *(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |