Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0181700_circ_g.3 |
ID in PlantcircBase | osa_circ_006341 |
Alias | NA |
Organism | Oryza sativa |
Position | chr10: 5604528-5605586 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os10g0181800 |
Parent gene annotation |
Hypothetical protein. (Os10t0181800-00) |
Parent gene strand | + |
Alternative splicing | Os10g0181700_circ_g.1 Os10g0181700_circ_g.2 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os10t0181700-01:2 Os10t0181700-01:2 Os10t0181800-00:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.115465534 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5605537-5604530(-) |
Potential amino acid sequence |
MNDDGLLELDFEDDDEDILLRDQDKASGGVTKAQKEIVQQHISHRLRFSLRFKDIVSHGTKVAI YNLWMNDDGLLELDFEDDDEDILLRDQDKASGGVTKAQKEIVQQHISHRLRFSLRFKDIVSHGT KVAIYNLWMNDDGLLELDFEDDDEDILLRDQDKASGGVTKAQKEIVQQHISHRLRFSLRFKDIV SHGTKVAIYNLWMNDDGLLELDFEDDDEDILLRDQDKASGGVTKAQKEIVQQHISHRLRFSLR( -) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |