Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G15400_circ_g.1 |
| ID in PlantcircBase | ath_circ_038392 |
| Alias | At_ciR5335 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 4998038-4998397 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | AT5G15400 |
| Parent gene annotation |
Probable ubiquitin conjugation factor E4 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G15400.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.229185204 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4998332-4998040(-) |
| Potential amino acid sequence |
MELGTKAKAAASEALDAEAALGEIPDEFLDPIQYTLMRDPVILPSSRITVDRPIIQRHLLSDNL FNAGADVLRRIGEEGRIIQEFMELGTKAKAAASEALDAEAALGEIPDEFLDPIQYTLMRDPVIL PSSRITVDRPIIQRHLLSDNLFNAGADVLRRIGEEGRIIQEFMELGTKAKAAASEALDAEAALG EIPDEFLDPIQYTLMRDPVILPSSRITVDRPIIQRHLLSDNLFNAGADVLRRIGEEGRIIQEFM ELGTKAKAAASEALDAEAALGEIPDEFLDPIQYTLMRDPVILPSSRITVDRPIIQRHLLSDN(- ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |