Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0352400_circ_g.1 |
| ID in PlantcircBase | osa_circ_023495 |
| Alias | Os04circ03081 |
| Organism | Oryza sativa |
| Position | chr4: 16815286-16815432 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl |
| Parent gene | Os04g0352400 |
| Parent gene annotation |
Peptidyl-prolyl cis-trans isomerase, FKBP-type domain containing protein. (Os04t0352400-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | leaf/shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0352400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.34069178 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16815420-16815429(+) |
| Potential amino acid sequence |
MYFAALVQSFSASLYSFSFSLQAALLSLQLTLSAFDCFFSSSVKELSYSMYFAALVQSFSASLY SFSFSLQAALLSLQLTLSAFDCFFSSSVKELSYSMYFAALVQSFSASLYSFSFSLQAALLSLQL TLSAFDCFFSSSVKELSYSMYFA(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Chu et al., 2017 |