Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | POPTR_0002s09960_circ_g.1 |
ID in PlantcircBase | pop_circ_000671 |
Alias | Chr02:7169450-7169781 |
Organism | Populus trichocarpa |
Position | chr2: 7149934-7150265 JBrowse» |
Reference genome | Populus trichocarpa genome v3.0 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | POPTR_0002s09960 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | stem xylem |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | POPTR_0002s09960.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.126004016 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7150172-7149973(+) 7150204-7149973(+) |
Potential amino acid sequence |
MPMNEPINSSGCTSIWPFIITRRCKGKIFAQFLSSIVCCPKSTPL*(+) MHKHMAIYHNKEMQRKDICSILEFYSLLSKVNSPLKNHVPDVLASGILYLDNGALKIVPWDGKG VPIVIGNCNLVPENWKEDDFLFGVWGKKQFECRKAGMPMNEPINSSGCTSIWPFIITRRCKGKI FAQFLSSIVCCPKSTPL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Liu et al., 2021 |