Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G54170_circ_g.1 |
ID in PlantcircBase | ath_circ_007285 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 20221483-20221551 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT1G54170 |
Parent gene annotation |
Polyadenylate-binding protein-interacting protein 3 |
Parent gene strand | - |
Alternative splicing | AT1G54170_circ_g.2 |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G54170.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.083333333 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
20221540-20221485(-) |
Potential amino acid sequence |
MMVTQQRPILFMPPTPYQPYPQPMMVTQQRPILFMPPTPYQPYPQPMMVTQQRPILFMPPTPYQ PYPQPMMVTQQRPILFMPPTPYQP(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |