Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0165400_circ_g.6 |
| ID in PlantcircBase | osa_circ_018094 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 3530154-3530266 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os03g0165400 |
| Parent gene annotation |
Similar to Relative to SR12 protein (Fragment). (Os03t0165400-01 );Similar to Beta-galactosidase. (Os03t0165400-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0165400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.421232375 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3530206-3530226(+) 3530196-3530177(+) 3530208-3530258(-) |
| Potential amino acid sequence |
MPAFWTVLMNLTRSYLPSKLYQNSTLHKCRDRCGDEQTCQPSGQS*(+) MNKHASLLDSLDEPDQIVPPFKIVPKFHSPQM*(+) MFVHLRIGPYICGEWNFGTILKGGTIWSGSSRLSRRLACLFISASVPTFVESGILVQF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |