Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0738400_circ_g.3 |
| ID in PlantcircBase | osa_circ_021771 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 30300468-30301147 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os03g0738400 |
| Parent gene annotation |
Similar to Serine hydroxymethyltransferase, cytosolic (EC 2.1.2. 1) (Serine methylase) (Glycine hydroxymethyltransferase) (SHMT). (Os03t0738400-01);Similar to Serine hydroxymethyltransferase. ( Os03t0738400-02);Similar to Serine hydroxymethyltransferase. (Os 03t0738400-03) |
| Parent gene strand | + |
| Alternative splicing | Os03g0738400_circ_g.4 Os03g0738400_circ_g.5 Os03g0738400_circ_g.6 Os03g0738400_circ_g.7 |
| Support reads | 9 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0738400-02:1 Os03t0738400-01:2 Os03t0738400-03:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.207720355 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30300479-30300473(+) 30301090-30300473(+) 30300475-30301078(-) |
| Potential amino acid sequence |
MAESLCQKRALEAFRLDPAKWGVNVQPLSGSPANFHVYTALLKPHERIMALDLPHGGHLSHGYQ IH*(+) MRESWLWIFLMVDIFLTATRYIDMAESLCQKRALEAFRLDPAKWGVNVQPLSGSPANFHVYTAL LKPHERIMALDLPHGGHLSHGYQIH*(+) MYLVAVRKMSTMRKIQSHDSLMWFQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |