Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0125800_circ_g.2 |
ID in PlantcircBase | osa_circ_012905 |
Alias | Os02circ02759 |
Organism | Oryza sativa |
Position | chr2: 1347811-1350024 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | SMALT, Segemehl |
Parent gene | Os02g0125800 |
Parent gene annotation |
Transcription factor Tfb4 family protein. (Os02t0125800-01) |
Parent gene strand | - |
Alternative splicing | Os02g0125800_circ_g.1 |
Support reads | 2 |
Tissues | panicle |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0125800-01:7 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.106270032 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1349897-1347841(+) 1347857-1347870(-) |
Potential amino acid sequence |
MTATYCSGPSGEPCRHKICGEHKEKSAV*(+) MAKYQTADFSLCSPQILCLQGSPDGPEQYVAVMNSIFSAQRSMVPIDSCIVGTQDSAFLQQASY ITGGVYLKPQELNGLFQYLAAVFATDLHSRTFLRLPKTLGVDFRASCFCHKKTIDMGYVCSVCL SIFCKYHKKCSTCGSEFNRVMPDLNSVPDQRQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015 |