Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0102800_circ_g.4 |
| ID in PlantcircBase | osa_circ_026148 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 164138-164254 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0102800 |
| Parent gene annotation |
Similar to AML1. (Os05t0102800-01);Similar to AML1. (Os05t010280 0-02);Similar to AML1. (Os05t0102800-03);Similar to AML6. (Os05t 0102800-04) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0102800-03:1 Os05t0102800-04:1 Os05t0102800-01:1 Os05t0102800-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.195983191 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
164191-164153(+) 164223-164140(-) |
| Potential amino acid sequence |
MEESMLDTTNIPLSISLPGTFSSFTSP*(+) MLVVSNIDSSISNDDLLQMLSVYGDVKEENVPGKDIDKGMLVVSNIDSSISNDDLLQMLSVYGD VKEENVPGKDIDKGMLVVSNIDSSISNDDLLQMLSVYGDVKEENVPGKDIDKGMLVVSNIDSSI SNDDLLQMLSVYGDVKE(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |