Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc07g018350.2_circ_g.2 |
| ID in PlantcircBase | sly_circ_002242 |
| Alias | 7:10375803|10376859 |
| Organism | Solanum lycopersicum |
| Position | chr7: 10375803-10376859 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | Segemehl, CIRI |
| Parent gene | Solyc07g018350.2 |
| Parent gene annotation |
DNA mismatch repair protein MSH7 |
| Parent gene strand | + |
| Alternative splicing | Solyc07g018340.2_circ_ag.1 Solyc07g018340.2_circ_ag.2 Solyc07g018350.2_circ_g.1 |
| Support reads | 3 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Solyc07g018350.2.1:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.183862189 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10375820-10376120(+) |
| Potential amino acid sequence |
MEQLETSEQAKSRGSTSVIRRKLVHVLTPSTTSEGNIGPDAVHLLAVKETCKELGNGSTTIGFA FVDCAALKVWVGSVEDDASCAALEALLMQVSPKEVIFNARGLSKDAQKALKKYSSTGTKLDGWN SWKHPSKQNLEALLLLFVEN*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | fruit ripening |
| Other Information | |
|---|---|
| References | Zuo et al., 2016; Tan et al., 2017; Yin et al., 2018 |