Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0315800_circ_g.1 |
| ID in PlantcircBase | osa_circ_038836 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 8712797-8713176 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0315800 |
| Parent gene annotation |
Phosphotransferase system, HPr serine phosphorylation site domai n containing protein. (Os09t0315800-01);Phosphotransferase syste m, HPr serine phosphorylation site domain containing protein. (O s09t0315800-02) |
| Parent gene strand | - |
| Alternative splicing | Os09g0315800_circ_g.2 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0315800-02:2 Os09t0315800-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_008007* |
| PMCS | 0.383188465 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8713098-8712824(+) 8712827-8713089(-) |
| Potential amino acid sequence |
MILLKMLQQHLLIKLLQQLTCFCLLITFHSRTATRA*(+) MPLWLYGCGRLSEDRSRSIVGAILSRGVAATFSTISSLSKIIWRSEPSPTKKSRPKPQSFAKTS PLTCLKDSPRKGERLTLSPSGTLAAITDSLGRILLLDTHALVAVRLWKVIRRQKQVNCWSNFIK RCCCNIFNNIISV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |