Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G17150_circ_g.3 |
| ID in PlantcircBase | ath_circ_031410 |
| Alias | At_ciR2048, AT4G17150_C2 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 9639334-9639719 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, find_circ, CIRI2 |
| Parent gene | AT4G17150 |
| Parent gene annotation |
Alpha/beta-Hydrolases superfamily protein |
| Parent gene strand | + |
| Alternative splicing | AT4G17150_circ_g.1 AT4G17150_circ_g.2 AT4G17150_circ_g.4 AT4G17150_circ_g.5 |
| Support reads | 4/3 |
| Tissues | leaf/root, aerial, whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G17150.2:2 AT4G17150.1:2 AT4G17150.3:2 AT4G17150.5:2 AT4G17150.4:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.572570166 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9639412-9639716(+) |
| Potential amino acid sequence |
MGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVDVYKIRLPKFTKDDLKTVVSYLRNSNQV SRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVDVYKIRLPKFTKDDLKTVV SYLRNSNQVSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVDVYKIRLPKF TKDDLKTVVSYLRNSNQVSRIGLWGRSMGAVTSLLYGAEDPSIAGMVLDSAFSNLFDLMMELVD VYKIRLPKFT(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017;Zhang et al., 2019 |