Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0278700_circ_g.1 |
ID in PlantcircBase | osa_circ_019169 |
Alias | Os_ciR9231 |
Organism | Oryza sativa |
Position | chr3: 9480662-9481008 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os03g0278700 |
Parent gene annotation |
Hypothetical conserved gene. (Os03t0278700-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2/3 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0278700-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.190509582 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9480813-9480698(+) 9480728-9480773(-) |
Potential amino acid sequence |
MAAGVPMTVLAAAAAAAAEEAPRERGLGPGPVAAEQPPASATPRPRPTMEMLTEEEKAGLSLLG LRCCRRCSSRSTRG*(+) MWPFWFFDVTPACFSNCSADSTSSQGETNRPSPPRSASPWSGAVGASPRPGAAPPPQAPAQAPA PAAPPQRRRRPRRRAPSWAPPRPSGMPRGISRRAPP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |