Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0716700_circ_g.8 |
ID in PlantcircBase | osa_circ_032357 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 30446479-30446644 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
Parent gene | Os06g0716700 |
Parent gene annotation |
Similar to Heat shock protein 90. (Os06t0716700-01);Similar to H eat shock protein 90. (Os06t0716700-02);Similar to Heat shock pr otein 90. (Os06t0716700-03) |
Parent gene strand | - |
Alternative splicing | Os06g0716700_circ_g.4 Os06g0716700_circ_g.5 Os06g0716700_circ_g.6 Os06g0716700_circ_g.7 |
Support reads | 240 |
Tissues | shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0716700-03:1 Os06t0716700-02:1 Os06t0716700-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.788007736 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30446624-30446554(+) 30446536-30446554(+) 30446601-30446585(-) 30446507-30446585(-) |
Potential amino acid sequence |
MCPSRRDPVLSLLLYSSGSSSASFLIMSRALRISFFLMVFRLLCCWSISRDTLRGNVSESTRPC LIFVAVLIRIFLSKFSNHVKSFAD*(+) MSRALRISFFLMVFRLLCCWSISRDTLRGNVSESTRPCLIFVAVLIRIFLSKFSNHVKSFAD*( +) MLQQHSSLKTIKKKLIRKALDMIRKLAEEDPDEYSNKDKTGSRRLGHIASQCITRNAPTT*(-) MSTATKIRQGLVDSDTLPLNVSREMLQQHSSLKTIKKKLIRKALDMIRKLAEEDPDEYSNKDKT GSRRLGHIASQCITRNAPTT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |