Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0716700_circ_g.8 |
| ID in PlantcircBase | osa_circ_032357 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 30446479-30446644 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | Os06g0716700 |
| Parent gene annotation |
Similar to Heat shock protein 90. (Os06t0716700-01);Similar to H eat shock protein 90. (Os06t0716700-02);Similar to Heat shock pr otein 90. (Os06t0716700-03) |
| Parent gene strand | - |
| Alternative splicing | Os06g0716700_circ_g.4 Os06g0716700_circ_g.5 Os06g0716700_circ_g.6 Os06g0716700_circ_g.7 |
| Support reads | 240 |
| Tissues | shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0716700-03:1 Os06t0716700-02:1 Os06t0716700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.788007736 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30446624-30446554(+) 30446536-30446554(+) 30446601-30446585(-) 30446507-30446585(-) |
| Potential amino acid sequence |
MCPSRRDPVLSLLLYSSGSSSASFLIMSRALRISFFLMVFRLLCCWSISRDTLRGNVSESTRPC LIFVAVLIRIFLSKFSNHVKSFAD*(+) MSRALRISFFLMVFRLLCCWSISRDTLRGNVSESTRPCLIFVAVLIRIFLSKFSNHVKSFAD*( +) MLQQHSSLKTIKKKLIRKALDMIRKLAEEDPDEYSNKDKTGSRRLGHIASQCITRNAPTT*(-) MSTATKIRQGLVDSDTLPLNVSREMLQQHSSLKTIKKKLIRKALDMIRKLAEEDPDEYSNKDKT GSRRLGHIASQCITRNAPTT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |