Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G06140_circ_g.9 |
| ID in PlantcircBase | ath_circ_036674 |
| Alias | At_ciR4427, Ath_circ_FC3177 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 1857771-1858386 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | AT5G06140 |
| Parent gene annotation |
Sorting nexin 1 |
| Parent gene strand | - |
| Alternative splicing | AT5G06140_circ_g.1 AT5G06140_circ_g.2 AT5G06140_circ_g.3 AT5G06140_circ_g.4 AT5G06140_circ_g.5 AT5G06140_circ_g.6 AT5G06140_circ_g.7 AT5G06140_circ_g.8 AT5G06140_circ_g.10 |
| Support reads | 3 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT5G06140.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.365055539 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1857873-1857773(-) |
| Potential amino acid sequence |
MRRAALDIFVNRIALHPELQQSEDLRTFLQADEETNLPEYQGPEKIVIRRYSDFVWLRDRLFEK YKGIFIPPLPEKSAVEKFRFSAEFIEMRRAALDIFVNRIALHPELQQSEDLRTFLQADEETNLP EYQGPEKIVIRRYSDFVWLRDRLFEKYKGIFIPPLPEKSAVEKFRFSAEFIEMRRAALDIFVNR IALHPELQQSEDLRTFLQADEETNLPEYQGPEKIVIRRYSDFVWLRDRLFEKYKGIFIPPLPEK SAVEKFRFSAEFIEMRRAALDIFVNRIALHPELQQSEDLRTFLQADEE(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chen et al., 2017a |