Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0601300_circ_g.10 |
| ID in PlantcircBase | osa_circ_015347 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 23529835-23529918 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os02g0601300 |
| Parent gene annotation |
Similar to Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 3 (EC 1.2.1.12). (Os02t0601300-01) |
| Parent gene strand | + |
| Alternative splicing | Os02g0601300_circ_g.11 |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0601350-00:1 Os02t0601300-01:1 Os02t0601350-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.299610714 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23529866-23529837(-) |
| Potential amino acid sequence |
MPLSLPSASSLLSPWKSVETRSSSTYPRMPLSLPSASSLLSPWKSVETRSSSTYPRMPLSLPSA SSLLSPWKSVETRSSSTYPRMPLSLPSASS(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |