Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0361200_circ_g.8 |
| ID in PlantcircBase | osa_circ_042073 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 17213106-17213714 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRI-long |
| Parent gene | Os05g0361200 |
| Parent gene annotation |
Similar to Ferrochelatase. (Os05t0361200-01);Similar to Ferroche latase. (Os05t0361200-02) |
| Parent gene strand | + |
| Alternative splicing | Os05g0361200_circ_g.2 Os05g0361200_circ_g.3 Os05g0361200_circ_g.4 Os05g0361200_circ_g.5 Os05g0361200_circ_g.6 Os05g0361200_circ_g.7 Os05g0361200_circ_g.9 Os05g0361200_circ_g.10 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0361200-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.186010099 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17213167-17213115(+) 17213622-17213107(+) 17213186-17213697(-) |
| Potential amino acid sequence |
MRYWHPFTEEAIEQIKRDGITKLVVLPLYPQFSISTSGSSLRLLEGIFRLKH*(+) MASQNLLYFLCTPSSPYQLVVQVSVYWRAYSG*(+) MDASNAFQHTPWQEYLYHIMLSSVLQPEYALQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | this study |