Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0521300_circ_g.2 |
| ID in PlantcircBase | osa_circ_028561 |
| Alias | Os_ciR10053 |
| Organism | Oryza sativa |
| Position | chr5: 25919365-25921467 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os05g0521300 |
| Parent gene annotation |
Similar to Histidine-containing phosphotransfer protein 4. (Os05 t0521300-01);Similar to Histidine-containing phosphotransfer pro tein 4. (Os05t0521300-02);Similar to histidine-containing phosph otransfer protein 4. (Os05t0521300-03);Similar to kinesin motor protein-related. (Os05t0521300-04) |
| Parent gene strand | - |
| Alternative splicing | Os05g0521300_circ_g.1 Os05g0521300_circ_g.3 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0521300-04:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.207669754 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25921355-25921418(-) |
| Potential amino acid sequence |
MVEIYNEQVRDLLSNDIAQKRLGIWSTSQPNGLVVPDASLHPVKSTSDVLDLMEIGQANRAVGS TALNERSSRSHSILTVHVRGLDVKNGSTSRGCLHLIDLAGSERVERSEATGDRLKEAQHINKSL SALGDVIFALAQKNAHVPYRNSKLTQVLQSSLGGQAKTLMFVQINPDVESYSETISTLKFAERV SGVELGAARSNKEGKDIKELLEQVASLKDTIVRKDTEIEQLQLMKDKVKSPSFAVDINGASMPK NSNSDLRSVLSITTNQQSQLSDPQSYAEVNRDGGPTSYTDITPTCLDEADFEDNASEDGFSGGT DYSVGCAAGASVFPNSCSDRTADTSIVDPAHQNKIGVSITGL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |