Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0782500_circ_g.1 |
| ID in PlantcircBase | osa_circ_004235 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 33155557-33156647 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0782500 |
| Parent gene annotation |
Phospholipid/glycerol acyltransferase domain containing protein. (Os01t0782500-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0782500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_010799 |
| PMCS | 0.223198992 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33156561-33156618(-) |
| Potential amino acid sequence |
MNGSSGSQGHNVNGGQKKVQHASPLTLNNGSKHRPLTPMRRCRGVACVVIILSTAFTLIVFIAP ITTFLVRLVSVHYSRKATSVLFGMWLSLWPFLFEKINKTNVVFSGESVLPKKRVLLFANHRTEV DWMYLWDLALRKGYLGYIKYILKSSLMKLPVFSWAFHIFEFIPVERKWEIDEAIIQNKLSAFKD PRDPLWLAVFPEGTDYTEKKCIKSQEYASEHGLPILKNVLLPKTKGFLCCLQELKSSLDAVLVS PTLQDV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |