Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0284100_circ_g.10 |
| ID in PlantcircBase | osa_circ_019222 |
| Alias | Os03circ11396 |
| Organism | Oryza sativa |
| Position | chr3: 9763624-9764371 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ei-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl |
| Parent gene | Os03g0284150 |
| Parent gene annotation |
Hypothetical protein. (Os03t0284150-00) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/1 |
| Tissues | leaf/shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0284100-02:2 Os03t0284100-01:3 Os03t0284150-00:3 Os03t0284100-02:2 Os03t0284100-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_004734* |
| PMCS | 0.324296591 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9763788-9763655(+) 9764287-9764299(-) |
| Potential amino acid sequence |
MPLSLPLPLELWHRLQTCCQRFLSSFLRIGFTRKSTAPFDKHLKTVPIESFEDIIITGISLQIL WLVILLSRPMPDRRGITTSVNTRSMWFCRSSRHCHACSPFSAGIIECHCHYHCHP*(+) MPRLSGIGLLSKITSHKICKDIPVIMMSSNDSMGTVFKCLSKGAVDFLVKPIRKNELKNLWQHV WRRCHSSSGSGSESGIRTQKCTKPKVDDEYENNSGSNNDNEDDDDNDEDDDDLSVGHNARDGSD NGSGTQLSLLKMGYMHGNVLKICKTTLTLY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Chu et al., 2017 |