Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0284100_circ_g.10 |
ID in PlantcircBase | osa_circ_019222 |
Alias | Os03circ11396 |
Organism | Oryza sativa |
Position | chr3: 9763624-9764371 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ei-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl |
Parent gene | Os03g0284150 |
Parent gene annotation |
Hypothetical protein. (Os03t0284150-00) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2/1 |
Tissues | leaf/shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0284100-02:2 Os03t0284100-01:3 Os03t0284150-00:3 Os03t0284100-02:2 Os03t0284100-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_004734* |
PMCS | 0.324296591 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9763788-9763655(+) 9764287-9764299(-) |
Potential amino acid sequence |
MPLSLPLPLELWHRLQTCCQRFLSSFLRIGFTRKSTAPFDKHLKTVPIESFEDIIITGISLQIL WLVILLSRPMPDRRGITTSVNTRSMWFCRSSRHCHACSPFSAGIIECHCHYHCHP*(+) MPRLSGIGLLSKITSHKICKDIPVIMMSSNDSMGTVFKCLSKGAVDFLVKPIRKNELKNLWQHV WRRCHSSSGSGSESGIRTQKCTKPKVDDEYENNSGSNNDNEDDDDNDEDDDDLSVGHNARDGSD NGSGTQLSLLKMGYMHGNVLKICKTTLTLY*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Chu et al., 2017 |