Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | POPTR_0004s22800_circ_g.2 |
| ID in PlantcircBase | pop_circ_001411 |
| Alias | Chr04:22518868-22520695 |
| Organism | Populus trichocarpa |
| Position | chr4: 21669652-21671479 JBrowse» |
| Reference genome | Populus trichocarpa genome v3.0 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | POPTR_0004s22800 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | POPTR_0004s22800_circ_g.3 |
| Support reads | NA |
| Tissues | stem xylem |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | POPTR_0004s22800.1:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.16123735 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21670746-21669682(+) 21669752-21671419(-) |
| Potential amino acid sequence |
MTYSVKWSLTNVSFARRFDVYLDYPFFEHQIHWFSIFNSFMMVIFLTGLVSMILMRTLRNDYAK YARDDDDLERDVSEETGWKLVHGDVFRPPRSLVVLSAVVGTGAQLAMLVLLVILMAIVGTLYVG MDKKKQLSFG*(+) MAKWKAVIVVCLLWIVIRTHFVYPKLNCFFLSIPTYNVPTIAIKMTRSTSIAS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Liu et al., 2021 |