Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G14430_circ_g.2 |
| ID in PlantcircBase | ath_circ_038230 |
| Alias | AT5G14430_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 4653717-4653899 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI, PcircRNA_finder, CIRI2 |
| Parent gene | AT5G14430 |
| Parent gene annotation |
Probable methyltransferase PMT9 |
| Parent gene strand | + |
| Alternative splicing | AT5G14430_circ_g.1 |
| Support reads | 8 |
| Tissues | root, inflorescences, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G14430.1:1 AT5G14430.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.664585005 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4653810-4653896(+) |
| Potential amino acid sequence |
MVVNGDKINFPGGGTHFHNGADKYIVSLAQIPLRWPVSRDEVWKANIPHTHLAQEKSDQNWMVV NGDKINFPGGGTHFHNGADKYIVSLAQIPLRWPVSRDEVWKANIPHTHLAQEKSDQNWMVVNGD KINFPGGGTHFHNGADKYIVSLAQIPLRWPVSRDEVWKANIPHTHLAQEKSDQNWMVVNGDKIN FPGGGTHFHNGADKYIVSLAQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Zhang et al., 2019 |