Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0421166_circ_g.1 |
ID in PlantcircBase | osa_circ_039225 |
Alias | Os_ciR1896 |
Organism | Oryza sativa |
Position | chr9: 15210400-15211005 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os09g0421166 |
Parent gene annotation |
Hypothetical conserved gene. (Os09t0421166-00) |
Parent gene strand | - |
Alternative splicing | Os09g0421166_circ_g.2 Os09g0421166_circ_g.3 |
Support reads | 6/2 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os09t0421166-00:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_018489 |
PMCS | 0.212931656 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15210956-15210468(+) |
Potential amino acid sequence |
MFLSFFRSRSDSSKVSLIFHFGFHDRYPRTQLIYSSFGLY*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |