Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.006G038900_circ_g.1 |
| ID in PlantcircBase | gra_circ_000569 |
| Alias | Chr06:10791041|10791367 |
| Organism | Gossypium raimondii |
| Position | chrChr06: 10791041-10791367 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.006G038900 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 6 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.006G038900.1:2 Gorai.006G038900.3:2 Gorai.006G038900.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.952104664 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10791086-10791065(+) 10791328-10791108(+) 10791093-10791064(-) |
| Potential amino acid sequence |
MAFRVPTVDVSVVDLTVRLEKKASYEDIKGAIKAESETNLKGILGYVDEDLVSTDFVGDSRLLA KCCHH*(+) MKTWYRLTLLGTAGCWQSVAIIEWQADWNGIPCSHS*(+) MPFQSACHSMMATLCQQPAVPNKVSRYQVFIYVAKNSFQISFRFRLDSALDIFIRSLLLKPNRE VNHRDINCGNTECHSSQLAIQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |