Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0535400_circ_g.2 |
ID in PlantcircBase | osa_circ_024686 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 26755149-26755389 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os04g0535400 |
Parent gene annotation |
Histidine triad motif domain containing protein. (Os04t0535400-0 1) |
Parent gene strand | - |
Alternative splicing | Os04g0535400_circ_g.1 |
Support reads | 1 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0535400-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.161828389 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26755363-26755183(+) 26755209-26755151(-) 26755175-26755315(-) |
Potential amino acid sequence |
MFNGYDKIVPLFLRIGSIPIE*(+) MLAVGRDLLNRDAPNSEEQRHYLVIPIEHIPTVNNLQRTTEDHQLVSHMLAVGRDLLNRDAPNS EEQRHYLVIPIEHIPTVNNLQRTTEDHQLVSHMLAVGRDLLNRDAPNSEEQRHYLVIPIEHIPT VNNLQRTTEDHQLVSHMLAVGRDLLNRDAPNSEEQ(-) MLPIRRNRGTILSYPLNIYLLSIISKEPPKITS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |