Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0105900_circ_g.1 |
ID in PlantcircBase | osa_circ_029319 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 404431-404817 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0105900 |
Parent gene annotation |
Conserved hypothetical protein. (Os06t0105900-01);Similar to cDN A clone:J023132J12, full insert sequence. (Os06t0105900-02) |
Parent gene strand | + |
Alternative splicing | Os06g0105900_circ_g.2 Os06g0105900_circ_g.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0105900-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.110465116 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
404439-404438(+) 404518-404514(+) 404441-404676(-) |
Potential amino acid sequence |
MRISYSRDFMISVGETDRCKKLPQGFDASLLSDLQEMSAGVLDRNKGYYTTPLGRSDGSGPYSY SSHGGSSGGRWETRSSGSSDRDGDLPDRDSSMQGAT*(+) MPHFSVICRRCPLACLTGTKATTLHPWGGPTAQVPILILLMAGAQGEGGKHAPLVQVTATEICL TVTHQCRAQHEDQLLQGLYDLRWRDRPLQEAAPGL*(+) MLRPALMSHGQANLRRGHLNQRSVFPTFPLSSRHEKNKNRDLSRRTSPGV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |