Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0105900_circ_g.1 |
| ID in PlantcircBase | osa_circ_029319 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 404431-404817 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0105900 |
| Parent gene annotation |
Conserved hypothetical protein. (Os06t0105900-01);Similar to cDN A clone:J023132J12, full insert sequence. (Os06t0105900-02) |
| Parent gene strand | + |
| Alternative splicing | Os06g0105900_circ_g.2 Os06g0105900_circ_g.3 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0105900-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.110465116 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
404439-404438(+) 404518-404514(+) 404441-404676(-) |
| Potential amino acid sequence |
MRISYSRDFMISVGETDRCKKLPQGFDASLLSDLQEMSAGVLDRNKGYYTTPLGRSDGSGPYSY SSHGGSSGGRWETRSSGSSDRDGDLPDRDSSMQGAT*(+) MPHFSVICRRCPLACLTGTKATTLHPWGGPTAQVPILILLMAGAQGEGGKHAPLVQVTATEICL TVTHQCRAQHEDQLLQGLYDLRWRDRPLQEAAPGL*(+) MLRPALMSHGQANLRRGHLNQRSVFPTFPLSSRHEKNKNRDLSRRTSPGV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |