Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G28290_circ_g.9 |
| ID in PlantcircBase | ath_circ_015320 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr2: 12063401-12063690 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT2G28290 |
| Parent gene annotation |
P-loop containing nucleoside triphosphate hydrolases superfamily protein |
| Parent gene strand | + |
| Alternative splicing | AT2G28290_circ_g.10 AT2G28290_circ_g.11 AT2G28290_circ_g.12 AT2G28290_circ_g.13 AT2G28290_circ_g.14 AT2G28290_circ_g.15 |
| Support reads | 1 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT2G28290.4:2 AT2G28290.2:2 AT2G28290.5:2 AT2G28290.1:2 AT2G28290.6:2 AT2G28290.3:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.369403756 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12063425-12063687(+) |
| Potential amino acid sequence |
MELRNICNHPYLSQLHSEEVNNIIPKHFLPPIVRLCGKLEMLDRMLPKLKATDHRSRAVHNSVM ELRNICNHPYLSQLHSEEVNNIIPKHFLPPIVRLCGKLEMLDRMLPKLKATDHRSRAVHNSVME LRNICNHPYLSQLHSEEVNNIIPKHFLPPIVRLCGKLEMLDRMLPKLKATDHRSRAVHNSVMEL RNICNHPYLSQLHSEEVNNIIPKHFLPPIVRLCGKLEMLDRMLPKLKATDHR(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |