Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.013G206900_circ_g.1 |
| ID in PlantcircBase | gra_circ_001445 |
| Alias | Chr13:51778142|51778333 |
| Organism | Gossypium raimondii |
| Position | chrChr13: 51778142-51778333 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.013G206900 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | orai.013G206800_circ_ag.1 orai.013G206800_circ_ag.2 orai.013G206800_circ_ag.3 |
| Support reads | 3 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.013G206900.3:2 Gorai.013G206900.1:2 Gorai.013G206900.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.183159462 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
51778321-51778144(-) 51778305-51778184(+) |
| Potential amino acid sequence |
MTRNTSLILKTKSQRVMMTFQKRFLIPMLRSLKIGMTRNTSLILKTKSQRVMMTFQKRFLIPML RSLKIGMTRNTSLILKTKSQRVMMTFQKRFLIPMLRSLKIGMTRNTSLILKTKSQRVMMTFQKR FLIPMLR(-) MYSLSSQSSGFLASGSGISFGMSS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |