Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0158200_circ_g.3 |
ID in PlantcircBase | osa_circ_029758 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 2970019-2971083 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os06g0158200 |
Parent gene annotation |
Sulfotransferase domain containing protein. (Os06t0158200-01) |
Parent gene strand | + |
Alternative splicing | Os06g0158200_circ_g.1 Os06g0158200_circ_g.2 |
Support reads | 3 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0158200-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.129832574 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2970342-2970189(+) |
Potential amino acid sequence |
MPLFQTQSRLDRMLYVGLTEEHEESARLFAHMVGAQVLSQSGALNLDIKDNQPTGNDSHSSTLD PEDEETNEHLITGLTNNSYLSGAHEVRHCVRKHPDLGHFVLQVAKVYTEEMDVEKKCRCVHLIS QSS*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |