Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G45740_circ_g.1 |
| ID in PlantcircBase | ath_circ_018582 |
| Alias | At_ciR352, AT2G45740_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 18840135-18840705 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, find_circ, CIRI-full, CIRI2 |
| Parent gene | AT2G45740 |
| Parent gene annotation |
Peroxisomal membrane protein 11D |
| Parent gene strand | + |
| Alternative splicing | AT2G45740_circ_g.2 AT2G45740_circ_g.3 AT2G45740_circ_g.4 AT2G45740_circ_g.5 AT2G45740_circ_g.6 |
| Support reads | 11/8 |
| Tissues | leaf/whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT2G45740.2:4 AT2G45740.3:4 AT2G45740.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.193464419 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18840509-18840702(+) |
| Potential amino acid sequence |
MGSSVCTTLVEVGEMGRLSSSMKKIEKGLKNGNKYQFVNDLHGLISPVPKGTPLPLVLLGKSKN ALLSTFLFLDQIVWLGRSGIYKNKERAELLGRISLFCWMGSSVCTTLVEVGEMGRLSSSMKKIE KGLKNGNKYQFVNDLHGLISPVPKGTPLPLVLLGKSKNALLSTFLFLDQIVWLGRSGIYKNKER AELLGRISLFCWMGSSVCTTLVEVGEMGRLSSSMKKIEKGLKNGNKYQFVNDLHGLISPVPKGT PLPLVLLGKSKNALLSTFLFLDQIVWLGRSGIYKNKERAELLGRISLFCWMGSSVCTTLVEVGE MGRLSSSMKKIEKGLKNGNKYQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017;Zhang et al., 2019 |