Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | LOC18042721_circ_g.1 |
| ID in PlantcircBase | ptr_circ_000340 |
| Alias | circRNA342 |
| Organism | Poncirus trifoliata |
| Position | chrNW_006262201.1: 36057973-36058505 JBrowse» |
| Reference genome | Citrus_clementina_v1.0 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | LOC18042721 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | LOC18042721_circ_g.2 |
| Support reads | NA |
| Tissues | shoots |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | XR_002905507.1:2 XR_002905504.1:2 XR_002905509.1:2 XR_002905510.1:2 XR_002905505.1:2 XR_002905511.1:2 XR_002905512.1:2 XM_024184633.1:2 XM_024184635.1:2 XM_024184634.1:2 XR_002905506.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
36058012-36057977(+) 36058468-36058009(+) |
| Potential amino acid sequence |
MALRFEVLGRFNRARAAQLTLPHFVCQTPLFMPVGTQGC*(+) MPDTFVYARGNTRLLKQQRKSKDLV*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | playing an important role in the early flowering process |
| Other Information | |
|---|---|
| References | Zeng et al., 2018 |