Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA017194_circ_g.3 |
| ID in PlantcircBase | osi_circ_005770 |
| Alias | 4:31060053|31060482 |
| Organism | Oryza sativa ssp. indica |
| Position | chr4: 31060053-31060482 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA017194 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | BGIOSGA017194_circ_g.2 BGIOSGA017194_circ_g.4 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | BGIOSGA017194-TA:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
31060075-31060101(+) 31060181-31060057(+) |
| Potential amino acid sequence |
MELFMELQVIGDRAVKKLAFSHIVHSIRRMNQTHKNEARNRKLQNILFTFLQGEEESRAKRAFT ILCDLHRRRVWFDDRTANAICNACFHGSSRLLIWRTQWSYLWSFKL*(+) MKPGIVNCKTSFSHSYRARKSREQRGPLLFYVIFTVGGSGLMTAQQMLYAMLVSMVLLDC*(+) |
| Sponge-miRNAs | osa-miR1432-5p |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |