Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA017194_circ_g.3 |
ID in PlantcircBase | osi_circ_005770 |
Alias | 4:31060053|31060482 |
Organism | Oryza sativa ssp. indica |
Position | chr4: 31060053-31060482 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA017194 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA017194_circ_g.2 BGIOSGA017194_circ_g.4 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA017194-TA:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
31060075-31060101(+) 31060181-31060057(+) |
Potential amino acid sequence |
MELFMELQVIGDRAVKKLAFSHIVHSIRRMNQTHKNEARNRKLQNILFTFLQGEEESRAKRAFT ILCDLHRRRVWFDDRTANAICNACFHGSSRLLIWRTQWSYLWSFKL*(+) MKPGIVNCKTSFSHSYRARKSREQRGPLLFYVIFTVGGSGLMTAQQMLYAMLVSMVLLDC*(+) |
Sponge-miRNAs | osa-miR1432-5p |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |