Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G31115_circ_g.1 |
| ID in PlantcircBase | ath_circ_033782 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr4: 15130419-15130652 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT4G31115 |
| Parent gene annotation |
Protein of unknown function (DUF1997) |
| Parent gene strand | + |
| Alternative splicing | AT4G31115_circ_g.2 |
| Support reads | 8 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G31115.1:1 AT4G31115.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.419915211 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
15130432-15130649(+) |
| Potential amino acid sequence |
MGNVHSGKRAMVISSLKKANISASRKQRIKLEINGEKELTFSEFLKHPSGMEAVINAKALQSYH LVDDSDDTYRERIHMGNVHSGKRAMVISSLKKANISASRKQRIKLEINGEKELTFSEFLKHPSG MEAVINAKALQSYHLVDDSDDTYRERIHMGNVHSGKRAMVISSLKKANISASRKQRIKLEINGE KELTFSEFLKHPSGMEAVINAKALQSYHLVDDSDDTYRERIHMGNVHSGKRAMVISSLKKANIS ASRKQRIKLEINGEKELTFSEFLKHPSGMEAVINAKALQSYHLVDDSDDTY(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |