Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d053515_circ_g.3 |
| ID in PlantcircBase | zma_circ_008280 |
| Alias | Zm04circ00105, GRMZM2G007854_C1 |
| Organism | Zea mays |
| Position | chr4: 232705368-232705663 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d053515 |
| Parent gene annotation |
Protein kinase superfamily protein |
| Parent gene strand | - |
| Alternative splicing | Zm00001d053515_circ_g.2 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d053515_T002:2 Zm00001d053515_T014:2 Zm00001d053515_T007:2 Zm00001d053515_T006:2 Zm00001d053515_T009:2 Zm00001d053515_T008:2 Zm00001d053515_T003:2 Zm00001d053515_T013:2 Zm00001d053515_T016:2 Zm00001d053515_T012:2 Zm00001d053515_T005:2 Zm00001d053515_T004:2 Zm00001d053515_T015:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.152533784 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
232705608-232705385(+) 232705610-232705370(-) 232705442-232705619(-) |
| Potential amino acid sequence |
MMFLSERTLKDLLPSSCSCLELAVL*(+) MLKSTNSMEGKMSCSSHSEPNVANAFCGRSRDKVVDEHQRTASSRQEQDDGNRSFKVLSLRNIM LKSTNSMEGKMSCSSHSEPNVANAFCGRSRDKVVDEHQRTASSRQEQDDGNRSFKVLSLRNIML KSTNSMEGKMSCSSHSEPNVANAFCGRSRDKVVDEHQRTASSRQEQDDGNRSFKVLSLRNIMLK STNSMEGKMSCSSHSEPNVANAFCGRSRDKVVDEHQRTASS(-) MLQMPSVVAAAIKLWMNIKELQAQGKSKMMAIDPSKSSH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020;Zhang et al., 2019 |