Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0532400_circ_g.7 |
| ID in PlantcircBase | osa_circ_039968 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 20888345-20888729 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0532400 |
| Parent gene annotation |
Signal transduction response regulator, receiver region domain c ontaining protein. (Os09t0532400-01);Signal transduction respons e regulator, receiver region domain containing protein. (Os09t05 32400-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0532400-01:2 Os09t0532400-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_008201* osi_circ_018690 |
| PMCS | 0.297377035 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20888434-20888403(+) 20888374-20888708(-) 20888636-20888708(-) |
| Potential amino acid sequence |
MHLKTMLTESFEDIIMTGIFLHASCSMIVESSRNPDIKGSSTSVKTRSILKDFSFSMSHAFTPS EAAATVVFSKHAAISSLIHSSVLA*(+) MAACLEKTTVAAASDGVKAWDILKEKSFNIDLVLTEVELPLMSGFLLLSTIMEHDACKNIPVIM MSSNDSVSMVFKCMLKGAADFLVKPIRKNELRNLWQHVWRKQLLPQPLMV*(-) MSGFLLLSTIMEHDACKNIPVIMMSSNDSVSMVFKCMLKGAADFLVKPIRKNELRNLWQHVWRK QLLPQPLMV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |