Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.001G172200_circ_g.1 |
| ID in PlantcircBase | gra_circ_000085 |
| Alias | Chr01:24748521|24749197 |
| Organism | Gossypium raimondii |
| Position | chrChr01: 24748521-24749197 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.001G172200 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.001G172200.1:3 Gorai.001G172200.2:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.133629505 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24748555-24748568(+) 24748550-24749163(-) |
| Potential amino acid sequence |
MKELHNLEKQLEGALARARQRKTQIMMEQMDDLRKKERQLGDLNKQLIVKAFAWRRSWTIEYER TA*(+) MVQDLLQANALTISCLLRSPS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |